PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 738aa    MW: 79622.7 Da    PI: 7.6347
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-095265631954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   n+yps +++  LA+++gL+ +qV++WF N R +
  XP_011085539.1 526 FEHflNPYPSDADKLLLARQTGLSRNQVSNWFINARVR 563
                     665569******************************88 PP

2BELL1245.8e-40386457172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er e+q++k+kLls+l+eVd+rY++y++q+q+v++sF++v+glg+a pYt lA+ka+SrhFrcLkdaia+q+
  XP_011085539.1 386 ERLEHQRRKVKLLSMLDEVDRRYNHYCDQMQMVVNSFDMVMGLGAAVPYTCLAQKAMSRHFRCLKDAIASQL 457
                     6889******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.6E-77311455IPR006563POX domain
PfamPF075268.4E-52316454IPR006563POX domain
PROSITE profilePS5007112.811504567IPR001356Homeobox domain
CDDcd000861.10E-12507568No hitNo description
SMARTSM003894.8E-10507571IPR001356Homeobox domain
SuperFamilySSF466891.67E-17509574IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-28510573IPR009057Homeodomain-like
PfamPF059207.3E-18524563IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MGIATPPFHS LTSHSSKDHN SLQFLDNSNS MSQDFHQGIF SFSNGLQEQQ QQQHLTQQIP  60
RDKLRVFQGF NPPPPLVGVE EEETGGLPVY ETASMLSEMF NLPTGGAASA TELLENQISQ  120
SYRNPRAAQL LSSADWFSHG QGLVVGGGLG GSKNQIVVSN STAPPHHHHH NQISRINGDS  180
MQLFLMNPQQ QRSPSPSPPP PSSTLHMLLP HPSSSSSSTL QAFQTASGQF TWVSNTGDVN  240
NPNEIPGVVE GQGLSLSLSS SLQRLEAVAK PEELRIGEGG LMFFGPGGGG GGALHLQGGL  300
SQNHVGLGSS FDGVNMLRNS KYAKAAQELL EEFCSVGRGQ FKRSKFGNSN RNPNSNPSGG  360
GGATSGGSGG GNTSSSKDLP PLSSSERLEH QRRKVKLLSM LDEVDRRYNH YCDQMQMVVN  420
SFDMVMGLGA AVPYTCLAQK AMSRHFRCLK DAIASQLKHS CEVLGEKDAA AASGLTKGET  480
PRLRILEQSL RQQRAFNQMG MMEQEAWRPQ RGLPERSVNI LRAWLFEHFL NPYPSDADKL  540
LLARQTGLSR NQVSNWFINA RVRLWKPMVE EMYQQEAKED TEQRERDQSS TSTGPAHNAQ  600
TPTPPHPSTT TTTTTTTGAA AFTPPPGGRS EINAHESDPS FVAINAHCFS ENQAKLQHVA  660
KNNDSLPAGA TPLAAASSTT AQPASRAALN AGIESRVMRF GTGAGDVSLT LGLRHAGNPT  720
EKGSFTVRDH FGGLPLRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-15513570158Homeobox protein Meis1
4xrs_A2e-15513570158Homeobox protein Meis1
5bng_A2e-15513571159Homeobox protein Meis2
5bng_B2e-15513571159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085539.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_011085540.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-165BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A022RUY30.0A0A022RUY3_ERYGU; Uncharacterized protein
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-132BEL1-like homeodomain 4